PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun012221
Common NameVuAP1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MIKC_MADS
Protein Properties Length: 237aa    MW: 27544.3 Da    PI: 9.2379
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Vun#S56866849PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.94.3e-31959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               krienk+nrqvtfskRr+g+lKKA+E+SvLCdaeva+i+fs++gkl+ey++
  Vun012221  9 KRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALIVFSHKGKLFEYAT 59
               79***********************************************86 PP

2K-box109.24.5e-36751741100
      K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                y++++ ++++++ + +++ e+++Lk++i+ Lqr++Rh++GedL+s+slkeLq+LeqqL+++lk+iR+++n+l++e+i+elqkkek +qe+n++L kk++e
  Vun012221  75 YAERQLVANDSESQGNWTIEYTRLKAKIDLLQRNHRHYMGEDLGSMSLKELQSLEQQLDTALKQIRTRRNQLMYESISELQKKEKVIQEQNNMLAKKIKE 174
                566777888889999**********************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.394161IPR002100Transcription factor, MADS-box
SMARTSM004327.7E-41160IPR002100Transcription factor, MADS-box
CDDcd002651.45E-42279No hitNo description
SuperFamilySSF554554.71E-34292IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-31323IPR002100Transcription factor, MADS-box
PfamPF003197.3E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-313859IPR002100Transcription factor, MADS-box
PfamPF014862.4E-3084172IPR002487Transcription factor, K-box
PROSITE profilePS5129717.07388178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MGRGRVQLKR IENKINRQVT FSKRRAGLLK KAHEISVLCD AEVALIVFSH KGKLFEYATD  60
SCMEKILERY ERYAYAERQL VANDSESQGN WTIEYTRLKA KIDLLQRNHR HYMGEDLGSM  120
SLKELQSLEQ QLDTALKQIR TRRNQLMYES ISELQKKEKV IQEQNNMLAK KIKEKEKVAA  180
QHAQWEHPNH GVNASFLLPQ PLLNMGGNYR EEAPEVGRNE LDLTLEPLFP ATLDAFX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D1e-21273171MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-21273171MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-21273171MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A1e-21273171MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J1e-21273171Myocyte-specific enhancer factor 2A
3p57_I1e-21273171Myocyte-specific enhancer factor 2A
3p57_D1e-21273171Myocyte-specific enhancer factor 2A
3p57_C1e-21273171Myocyte-specific enhancer factor 2A
3p57_B1e-21273171Myocyte-specific enhancer factor 2A
3p57_A1e-21273171Myocyte-specific enhancer factor 2A
3kov_J1e-21273171Myocyte-specific enhancer factor 2A
3kov_I1e-21273171Myocyte-specific enhancer factor 2A
3kov_B1e-21273171Myocyte-specific enhancer factor 2A
3kov_A1e-21273171Myocyte-specific enhancer factor 2A
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014507468.11e-170PREDICTED: truncated transcription factor CAULIFLOWER A-like
SwissprotD7KWY61e-124AP1_ARALL; Floral homeotic protein APETALA 1
TrEMBLE1CKY31e-171E1CKY3_VIGUN; APETALA1
STRINGGLYMA16G13070.11e-168(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.11e-104MIKC_MADS family protein